2yad/2/1:D/1:C

Sequences
>2yad-a2-m1-cD (length=76) [Search sequence]
LVTTATFSIGSTGLVVYDYQQLLIAYKPAPGTCCYIKIAPESIPSLEALTRKVHNFQECF
LGAVSTLCGEVPLYYI
>2yad-a2-m1-cC (length=80) [Search sequence]
HLVTTATFSIGSTGLVVYDYQQLLIAYKPAPGTCCYIKIAPESIPSLEALTRKVHNFQEC
SLQFLGAVSTLCGEVPLYYI
Structure information
PDB ID 2yad (database links: RCSB PDB PDBe PDBj PDBsum)
Title BRICHOS domain of Surfactant protein C precursor protein
Assembly ID 2
Resolution 2.2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 45
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D C
UniProt accession P11686 P11686
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2yad-a2-m1-cD_2yad-a2-m1-cC.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 2yad-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2yad/1/1:A/1:B 2yad/1/1:E/1:B 2yad/2/1:F/1:C 2yad/2/1:F/1:D

[Back to Home]