2yad/2/1:D/1:C

Sequences

>2yad-a2-m1-cD (length=76) [Search sequence]

LVTTATFSIGSTGLVVYDYQQLLIAYKPAPGTCCYIKIAPESIPSLEALTRKVHNFQECF LGAVSTLCGEVPLYYI

>2yad-a2-m1-cC (length=80) [Search sequence]

HLVTTATFSIGSTGLVVYDYQQLLIAYKPAPGTCCYIKIAPESIPSLEALTRKVHNFQEC SLQFLGAVSTLCGEVPLYYI

Structure information

PDB ID	2yad (database links: RCSB PDB PDBe PDBj PDBsum)
Title	BRICHOS domain of Surfactant protein C precursor protein
Assembly ID	2
Resolution	2.2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	45
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	C
UniProt accession	P11686	P11686
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2yad-a2-m1-cD_2yad-a2-m1-cC.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 2yad-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures

2yad/1/1:A/1:B 2yad/1/1:E/1:B 2yad/2/1:F/1:C 2yad/2/1:F/1:D