2yal/1/1:B/1:A

Sequences
>2yal-a1-m1-cB (length=38) [Search sequence]
GPAIDSEWEKLVRDAMTSGVSKKQFREFLDYQKWRKSQ
>2yal-a1-m1-cA (length=39) [Search sequence]
GPAIDSEWEKLVRDAMTSGVSKKQFREFLDYQKWRKSQK
Structure information
PDB ID 2yal (database links: RCSB PDB PDBe PDBj PDBsum)
Title SinR, Master Regulator of biofilm formation in Bacillus subtilis
Assembly ID 1
Resolution 2.27Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 65
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession P06533 P06533
Species 1423 (Bacillus subtilis) 1423 (Bacillus subtilis)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2yal-a1-m1-cB_2yal-a1-m1-cA.pdb.gz
Full biological assembly
Download: 2yal-assembly1.cif.gz

[Back to Home]