2yf2/1/1:A/1:G

Sequences
>2yf2-a1-m1-cA (length=57) [Search sequence]
ADVCGEVAYIQSVVSDCHVPTEDVKTLLEIRKLFLEIQKLKVELQGLSKEFLEHILH
>2yf2-a1-m1-cG (length=57) [Search sequence]
DVCGEVAYIQSVVSDCHVPTEDVKTLLEIRKLFLEIQKLKVELQGLSKEFLEHILHG
Structure information
PDB ID 2yf2 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the oligomerisation domain of C4b-binding protein from Gallus gallus
Assembly ID 1
Resolution 2.24Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 59
Sequence identity between the two chains 0.982
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A G
UniProt accession
Species 9031 (Gallus gallus) 9031 (Gallus gallus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2yf2-a1-m1-cA_2yf2-a1-m1-cG.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 2yf2-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2yf2/1/1:D/1:C 2yf2/1/1:F/1:G

[Back to Home]