2yh9/1/2:A/2:C

Sequences

>2yh9-a1-m2-cA (length=64) [Search sequence]

VSKIRVGTQQQVAYALGTPLSDPFGTNTWFYVFRQQPGHEGVTQQTLTLTFNSSGVLTNI DNKP

>2yh9-a1-m2-cC (length=65) [Search sequence]

VSKIRVGTQQQVAYALGTPLSDPFGTNTWFYVFRQQPGHEGVTQQTLTLTFNSSGVLTNI DNKPA

Structure information

PDB ID	2yh9 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the dimeric BamE from E. coli
Assembly ID	1
Resolution	1.8Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	110
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	2	2
Chain ID	A	C
UniProt accession	P0A937	P0A937
Species	83333 (Escherichia coli K-12)	83333 (Escherichia coli K-12)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 2yh9-a1-m2-cA_2yh9-a1-m2-cC.pdb.gz

Full biological assembly Download: 2yh9-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2yh9/1/1:A/1:C 2yh9/1/1:B/2:B
Other dimers with similar sequences but different poses	2yh9/1/2:A/2:B 2yh9/1/1:A/1:B 2yh9/1/2:C/2:B 2yh9/1/1:A/2:A 2yh9/1/1:C/1:B