2yh9/1/2:C/2:B

Sequences
>2yh9-a1-m2-cC (length=65) [Search sequence]
VSKIRVGTQQQVAYALGTPLSDPFGTNTWFYVFRQQPGHEGVTQQTLTLTFNSSGVLTNI
DNKPA
>2yh9-a1-m2-cB (length=66) [Search sequence]
VSKIRVGTQQQVAYALGTPLSDPFGTNTWFYVFRQQPGHEGVTQQTLTLTFNSSGVLTNI
DNKPAL
Structure information
PDB ID 2yh9 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the dimeric BamE from E. coli
Assembly ID 1
Resolution 1.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 68
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID C B
UniProt accession P0A937 P0A937
Species 83333 (Escherichia coli K-12) 83333 (Escherichia coli K-12)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2yh9-a1-m2-cC_2yh9-a1-m2-cB.pdb.gz
Full biological assembly
Download: 2yh9-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2yh9/1/1:A/2:A 2yh9/1/1:C/1:B
Other dimers with similar sequences but different poses
  • 2yh9/1/2:A/2:B 2yh9/1/1:A/1:B
  • 2yh9/1/2:A/2:C 2yh9/1/1:A/1:C 2yh9/1/1:B/2:B
  • [Back to Home]