2ymy/1/1:A/1:B

Sequences
>2ymy-a1-m1-cA (length=40) [Search sequence]
SPELQNFLTILEKEEQDKIHQLQKKYNKFRQKLEEALRES
>2ymy-a1-m1-cB (length=41) [Search sequence]
GSPELQNFLTILEKEEQDKIHQLQKKYNKFRQKLEEALRES
Structure information
PDB ID 2ymy (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of the murine Nore1-Sarah domain
Assembly ID 1
Resolution 1.69Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 35
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q5EBH1 Q5EBH1
Species 10090 (Mus musculus) 10090 (Mus musculus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2ymy-a1-m1-cA_2ymy-a1-m1-cB.pdb.gz
Full biological assembly
Download: 2ymy-assembly1.cif.gz

[Back to Home]