2yvr/1/1:A/1:B

Sequences
>2yvr-a1-m1-cA (length=45) [Search sequence]
GERTVYCNVHKHEPLVLFCESCDTLTCRDCQLNAHKDHQYQFLED
>2yvr-a1-m1-cB (length=45) [Search sequence]
GERTVYCNVHKHEPLVLFCESCDTLTCRDCQLNAHKDHQYQFLED
Structure information
PDB ID 2yvr (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of MS1043
Assembly ID 1
Resolution 1.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 29
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q13263 Q13263
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:2yvrA BioLiP:2yvrB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2yvr-a1-m1-cA_2yvr-a1-m1-cB.pdb.gz
Full biological assembly
Download: 2yvr-assembly1.cif.gz

[Back to Home]