2ywa/2/1:C/1:D

Sequences
>2ywa-a2-m1-cC (length=113) [Search sequence]
SLARAVERLKAALERPKDEFIRDSAIQRFEFTFELAWKTLKTFLELQGLEARSPRAAIRG
AFQVGLLPEDPFWLELELRNLTNHTYDEALAERIYAELPKALERFQELLRRLE
>2ywa-a2-m1-cD (length=114) [Search sequence]
ASLARAVERLKAALERPKDEFIRDSAIQRFEFTFELAWKTLKTFLELQGLEARSPRAAIR
GAFQVGLLPEDPFWLELELRNLTNHTYDEALAERIYAELPKALERFQELLRRLE
Structure information
PDB ID 2ywa (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of uncharacterized conserved protein from Thermus thermophilus HB8
Assembly ID 2
Resolution 3.2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 66
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C D
UniProt accession Q5SM95 Q5SM95
Species 300852 (Thermus thermophilus HB8) 300852 (Thermus thermophilus HB8)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2ywa-a2-m1-cC_2ywa-a2-m1-cD.pdb.gz
Full biological assembly
Download: 2ywa-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1wty/1/1:B/1:C 1wty/1/1:D/1:A 2ywa/1/1:A/1:B
Other dimers with similar sequences but different poses
  • 1wty/1/1:B/1:D 1wty/1/1:C/1:A
  • [Back to Home]