2yx5/1/1:A/4:A

Sequences
>2yx5-a1-m1-cA (length=82) [Search sequence]
MYKATVIIKLKKGVLNPEGRTIQRALNFLGFNNVKEVQTYKMIDIIMEENEEKVKEEVEE
MCKKLLANPVIHDYEIKVEKIE
>2yx5-a1-m4-cA (length=82) [Search sequence]
MYKATVIIKLKKGVLNPEGRTIQRALNFLGFNNVKEVQTYKMIDIIMEENEEKVKEEVEE
MCKKLLANPVIHDYEIKVEKIE
Structure information
PDB ID 2yx5 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of Methanocaldococcus jannaschii PurS, One of the Subunits of Formylglycinamide Ribonucleotide Amidotransferase in the Purine Biosynthetic Pathway
Assembly ID 1
Resolution 2.3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 90
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 4
Chain ID A A
UniProt accession Q58988 Q58988
Species 2190 (Methanocaldococcus jannaschii) 2190 (Methanocaldococcus jannaschii)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2yx5-a1-m1-cA_2yx5-a1-m4-cA.pdb.gz
Full biological assembly
Download: 2yx5-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 2yx5/1/3:A/4:A 2yx5/1/1:A/2:A
  • 2yx5/1/2:A/4:A 2yx5/1/1:A/3:A
  • [Back to Home]