2yx7/1/6:A/8:A |
| >2yx7-a1-m6-cA (length=150) [Search sequence] |
MDEIDLRILKILQYNAKYSLDEIAREIRIPKSTLSYRIKKLEKDGVIKGYYAYINPASLN LDYIVITSVKAKYGKNYHVELGNKLAQIPGVWGVYFVLGDNDFIVMARYKTREEFMEKFL ERVMSIPEVERASTQVVVKIIKESPNIVIF |
| >2yx7-a1-m8-cA (length=150) [Search sequence] |
MDEIDLRILKILQYNAKYSLDEIAREIRIPKSTLSYRIKKLEKDGVIKGYYAYINPASLN LDYIVITSVKAKYGKNYHVELGNKLAQIPGVWGVYFVLGDNDFIVMARYKTREEFMEKFL ERVMSIPEVERASTQVVVKIIKESPNIVIF |
|
| PDB ID |
2yx7 (database links:
RCSB PDB
PDBe
PDBj
PDBsum) |
| Title |
Crystals structure of T132A mutant of St1022 from sulfolobus tokodaii 7 |
| Assembly ID |
1 |
| Resolution |
2.05Å |
| Method of structure determination |
X-RAY DIFFRACTION |
| Number of inter-chain contacts |
33 |
| Sequence identity between the two chains |
1.0 |
| PubMed citation |
18653535 |
|
|
Chain 1 |
Chain 2 |
| Model ID |
6 |
8 |
| Chain ID |
A |
A |
| UniProt accession |
F9VNT4 |
F9VNT4 |
| Species |
111955 (Sulfurisphaera tokodaii) |
111955 (Sulfurisphaera tokodaii) |
| Function annotation |
BioLiP:2yx7A |
BioLiP:2yx7A |
|
Switch viewer: [NGL] [JSmol]
|
Dimer structure:
Chain 1 in red;
Chain 2 in blue.
|
Full biological assembly
|
|
| Other dimers with similar sequences and structures |
2e7w/1/1:A/3:A 2e7w/1/1:A/4:A 2e7w/1/2:A/3:A 2e7w/1/2:A/4:A 2e7w/1/5:A/7:A 2e7w/1/5:A/8:A 2e7w/1/6:A/7:A 2e7w/1/6:A/8:A 2e7x/1/1:A/3:A 2e7x/1/1:A/4:A 2e7x/1/2:A/3:A 2e7x/1/2:A/4:A 2e7x/1/5:A/7:A 2e7x/1/5:A/8:A 2e7x/1/6:A/7:A 2e7x/1/6:A/8:A 2efn/1/1:A/3:A 2efn/1/1:A/4:A 2efn/1/2:A/3:A 2efn/1/2:A/4:A 2efn/1/5:A/7:A 2efn/1/5:A/8:A 2efn/1/6:A/7:A 2efn/1/6:A/8:A 2efo/1/1:A/3:A 2efo/1/1:A/4:A 2efo/1/2:A/3:A 2efo/1/2:A/4:A 2efo/1/5:A/7:A 2efo/1/5:A/8:A 2efo/1/6:A/7:A 2efo/1/6:A/8:A 2efp/1/1:A/3:A 2efp/1/1:A/4:A 2efp/1/2:A/3:A 2efp/1/2:A/4:A 2efp/1/5:A/7:A 2efp/1/5:A/8:A 2efp/1/6:A/7:A 2efp/1/6:A/8:A 2efq/1/1:A/3:A 2efq/1/1:A/4:A 2efq/1/2:A/3:A 2efq/1/2:A/4:A 2efq/1/5:A/7:A 2efq/1/5:A/8:A 2efq/1/6:A/7:A 2efq/1/6:A/8:A 2pmh/1/1:A/3:A 2pmh/1/1:A/4:A 2pmh/1/2:A/3:A 2pmh/1/2:A/4:A 2pmh/1/5:A/7:A 2pmh/1/5:A/8:A 2pmh/1/6:A/7:A 2pmh/1/6:A/8:A 2pn6/1/1:A/3:A 2pn6/1/1:A/4:A 2pn6/1/2:A/3:A 2pn6/1/2:A/4:A 2pn6/1/5:A/7:A 2pn6/1/5:A/8:A 2pn6/1/6:A/7:A 2pn6/1/6:A/8:A 2yx4/1/1:A/3:A 2yx4/1/1:A/4:A 2yx4/1/2:A/3:A 2yx4/1/2:A/4:A 2yx4/1/5:A/7:A 2yx4/1/5:A/8:A 2yx4/1/6:A/7:A 2yx4/1/6:A/8:A 2yx7/1/1:A/3:A 2yx7/1/1:A/4:A 2yx7/1/2:A/3:A 2yx7/1/2:A/4:A 2yx7/1/5:A/7:A 2yx7/1/5:A/8:A 2yx7/1/6:A/7:A |
| Other dimers with similar sequences but different poses |
2yx7/1/4:A/8:A 2e7w/1/1:A/6:A 2e7w/1/2:A/5:A 2e7w/1/3:A/7:A 2e7w/1/4:A/8:A 2e7x/1/1:A/5:A 2e7x/1/2:A/6:A 2e7x/1/3:A/8:A 2e7x/1/4:A/7:A 2efn/1/1:A/6:A 2efn/1/2:A/5:A 2efn/1/3:A/7:A 2efn/1/4:A/8:A 2efo/1/1:A/5:A 2efo/1/2:A/6:A 2efo/1/3:A/8:A 2efo/1/4:A/7:A 2efp/1/1:A/6:A 2efp/1/2:A/5:A 2efp/1/3:A/7:A 2efp/1/4:A/8:A 2efq/1/1:A/5:A 2efq/1/2:A/6:A 2efq/1/3:A/8:A 2efq/1/4:A/7:A 2pmh/1/1:A/5:A 2pmh/1/2:A/6:A 2pmh/1/3:A/8:A 2pmh/1/4:A/7:A 2pn6/1/1:A/5:A 2pn6/1/2:A/6:A 2pn6/1/3:A/8:A 2pn6/1/4:A/7:A 2yx4/1/1:A/5:A 2yx4/1/2:A/6:A 2yx4/1/3:A/8:A 2yx4/1/4:A/7:A 2yx7/1/1:A/6:A 2yx7/1/2:A/5:A 2yx7/1/3:A/7:A
2yx7/1/2:A/8:A 2e7w/1/1:A/7:A 2e7w/1/2:A/8:A 2e7w/1/3:A/5:A 2e7w/1/4:A/6:A 2e7x/1/1:A/7:A 2e7x/1/2:A/8:A 2e7x/1/3:A/5:A 2e7x/1/4:A/6:A 2efn/1/1:A/7:A 2efn/1/2:A/8:A 2efn/1/3:A/5:A 2efn/1/4:A/6:A 2efo/1/1:A/7:A 2efo/1/2:A/8:A 2efo/1/3:A/5:A 2efo/1/4:A/6:A 2efp/1/1:A/7:A 2efp/1/2:A/8:A 2efp/1/3:A/5:A 2efp/1/4:A/6:A 2efq/1/1:A/7:A 2efq/1/2:A/8:A 2efq/1/3:A/5:A 2efq/1/4:A/6:A 2pmh/1/1:A/7:A 2pmh/1/2:A/8:A 2pmh/1/3:A/5:A 2pmh/1/4:A/6:A 2pn6/1/1:A/7:A 2pn6/1/2:A/8:A 2pn6/1/3:A/5:A 2pn6/1/4:A/6:A 2yx4/1/1:A/7:A 2yx4/1/2:A/8:A 2yx4/1/3:A/5:A 2yx4/1/4:A/6:A 2yx4/2/1:A/7:A 2yx7/1/1:A/7:A 2yx7/1/3:A/5:A 2yx7/1/4:A/6:A |
|