2yy0/3/3:C/3:A

Sequences
>2yy0-a3-m3-cC (length=37) [Search sequence]
ENPEIELLRLELAEMKEKYEAIVEENKKLKAKLAQYE
>2yy0-a3-m3-cA (length=38) [Search sequence]
PENPEIELLRLELAEMKEKYEAIVEENKKLKAKLAQYE
Structure information
PDB ID 2yy0 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of MS0802, c-Myc-1 binding protein domain from Homo sapiens
Assembly ID 3
Resolution 2.4Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 34
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 3 3
Chain ID C A
UniProt accession Q99417 Q99417
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2yy0-a3-m3-cC_2yy0-a3-m3-cA.pdb.gz
Full biological assembly
Download: 2yy0-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2yy0/3/1:C/1:A 2yy0/3/2:C/2:A
Other dimers with similar sequences but different poses
  • 2yy0/3/3:C/3:D 2yy0/1/1:A/1:B 2yy0/2/1:C/1:D 2yy0/3/1:A/1:B 2yy0/3/1:C/1:D 2yy0/3/2:A/2:B 2yy0/3/2:C/2:D 2yy0/3/3:A/3:B
  • 2yy0/3/2:A/3:D 2yy0/3/1:A/2:D 2yy0/3/3:A/1:D
  • 2yy0/3/2:D/3:D 2yy0/3/1:D/2:D 2yy0/3/1:D/3:D
  • [Back to Home]