2yyr/1/1:A/1:B

Sequences
>2yyr-a1-m1-cA (length=58) [Search sequence]
PVYPCGICTNEVNDDQDAILCEASCQKWFHRICTGTETAYGLLTAEASAVWGCDTCAD
>2yyr-a1-m1-cB (length=58) [Search sequence]
PVYPCGICTNEVNDDQDAILCEASCQKWFHRICTGTETAYGLLTAEASAVWGCDTCAD
Structure information
PDB ID 2yyr (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structural analysis of PHD domain of Pygopus complexed with trimethylated histone H3 peptide
Assembly ID 1
Resolution 2.5Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 36
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q9D0P5 Q9D0P5
Species 10090 (Mus musculus) 10090 (Mus musculus)
Function annotation BioLiP:2yyrA BioLiP:2yyrB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2yyr-a1-m1-cA_2yyr-a1-m1-cB.pdb.gz
Full biological assembly
Download: 2yyr-assembly1.cif.gz
Similar dimers

[Back to Home]