2z06/1/1:A/1:C

Sequences

>2z06-a1-m1-cA (length=252) [Search sequence]

MRVLFIGDVMAEPGLRAVGLHLPDIRDRYDLVIANGENAARGKGLDRRSYRLLREAGVDL
VSLGNHAWDHKEVYALLESEPVVRPLNYPPGTPGKGFWRLEVGGESLLFVQVMGRIFMDP
LDDPFRALDRLLEEEKADYVLVEVHAEATSEKMALAHYLDGRASAVLGTHTHVPTLDATR
LPKGTLYQTDVGMTGTYHSIIGGEVETFLARFLTGRPQPFRAAQGKARFHATELVFEGGR
PVAISPYVWEEP

>2z06-a1-m1-cC (length=252) [Search sequence]

Structure information

PDB ID	2z06 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of uncharacterized conserved protein from Thermus thermophilus
Assembly ID	1
Resolution	2.2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	29
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	C
UniProt accession	Q5SKL8	Q5SKL8
Species	300852 (Thermus thermophilus HB8)	300852 (Thermus thermophilus HB8)
Function annotation	BioLiP:2z06A	BioLiP:2z06C

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	2z06-a1-m1-cA_2z06-a1-m1-cC.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	2z06-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2cv9/3/1:A/2:B 2cv9/3/1:D/2:C 2z06/1/1:B/1:D
Other dimers with similar sequences but different poses	2z06/1/1:C/1:D 2cv9/1/1:A/1:D 2cv9/2/1:B/1:C 2cv9/3/1:A/1:D 2cv9/3/2:B/2:C 2z06/1/1:A/1:B 2z06/1/1:A/1:D 2cv9/3/1:A/2:C 2cv9/3/1:D/2:B 2z06/1/1:B/1:C