2z0r/7/1:A/1:B

Sequences

>2z0r-a7-m1-cA (length=94) [Search sequence]

LSGTWYVLEGDPGEHLVVEALGERLSGIWTSRELAEAFLAHHPHLGRVSALESRALKEAY LRALGLQVEAVVDYRPGTHRAQVARVKDLLEEVR

>2z0r-a7-m1-cB (length=97) [Search sequence]

DLSGTWYVLEGDPGEHLVVEALGERLSGIWTSRELAEAFLAHHPHLGRVSALESRALKEA YLRALGLQVEAVVDYRPGTHRAQVARVKDLLEEVRRA

Structure information

PDB ID	2z0r (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of hypothetical protein TTHA0547
Assembly ID	7
Resolution	2.3Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	55
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	Q5SKU6	Q5SKU6
Species	300852 (Thermus thermophilus HB8)	300852 (Thermus thermophilus HB8)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 2z0r-a7-m1-cA_2z0r-a7-m1-cB.pdb.gz

Full biological assembly Download: 2z0r-assembly7.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2z0r/1/1:A/1:B 2z0r/2/1:D/1:C 2z0r/3/1:E/1:F 2z0r/4/1:H/1:G 2z0r/5/1:J/1:I 2z0r/6/1:K/1:L 2z0r/7/1:D/1:C 2z0r/7/1:E/1:F 2z0r/8/1:H/1:G 2z0r/8/1:J/1:I 2z0r/8/1:K/1:L
Other dimers with similar sequences but different poses	2z0r/7/1:A/1:F 2z0r/7/1:C/1:E 2z0r/7/1:D/1:B 2z0r/8/1:G/1:L 2z0r/8/1:H/1:J 2z0r/8/1:K/1:I