2z0r/7/1:A/1:F

Sequences
>2z0r-a7-m1-cA (length=94) [Search sequence]
LSGTWYVLEGDPGEHLVVEALGERLSGIWTSRELAEAFLAHHPHLGRVSALESRALKEAY
LRALGLQVEAVVDYRPGTHRAQVARVKDLLEEVR
>2z0r-a7-m1-cF (length=96) [Search sequence]
LSGTWYVLEGDPGEHLVVEALGERLSGIWTSRELAEAFLAHHPHLGRVSALESRALKEAY
LRALGLQVEAVVDYRPGTHRAQVARVKDLLEEVRRA
Structure information
PDB ID 2z0r (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of hypothetical protein TTHA0547
Assembly ID 7
Resolution 2.3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 34
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A F
UniProt accession Q5SKU6 Q5SKU6
Species 300852 (Thermus thermophilus HB8) 300852 (Thermus thermophilus HB8)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2z0r-a7-m1-cA_2z0r-a7-m1-cF.pdb.gz
Full biological assembly
Download: 2z0r-assembly7.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2z0r/7/1:C/1:E 2z0r/7/1:D/1:B 2z0r/8/1:G/1:L 2z0r/8/1:H/1:J 2z0r/8/1:K/1:I
Other dimers with similar sequences but different poses
  • 2z0r/7/1:A/1:B 2z0r/1/1:A/1:B 2z0r/2/1:D/1:C 2z0r/3/1:E/1:F 2z0r/4/1:H/1:G 2z0r/5/1:J/1:I 2z0r/6/1:K/1:L 2z0r/7/1:D/1:C 2z0r/7/1:E/1:F 2z0r/8/1:H/1:G 2z0r/8/1:J/1:I 2z0r/8/1:K/1:L
  • [Back to Home]