2z3x/1/1:A/1:C

Sequences

>2z3x-a1-m1-cA (length=56) [Search sequence]

AKLLIPQAASAIEQMKLEIASEFGVQLGAETTSRANGSVGGEITKRLVRLAQQNMG

>2z3x-a1-m1-cC (length=56) [Search sequence]

AKLLIPQAASAIEQMKLEIASEFGVQLGAETTSRANGSVGGEITKRLVRLAQQNMG

Structure information

PDB ID	2z3x (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of a Protein-DNA Complex Essential for DNA Protection in Spore of Bacillus Species
Assembly ID	1
Resolution	2.1Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	63
Sequence identity between the two chains	1.0
PubMed citation	18287075

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	C
UniProt accession	P02958	P02958
Species	1423 (Bacillus subtilis)	1423 (Bacillus subtilis)
Function annotation	BioLiP:2z3xA	BioLiP:2z3xC

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2z3x-a1-m1-cA_2z3x-a1-m1-cC.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 2z3x-assembly1.cif.gz