2z4p/1/2:A/2:B

Sequences
>2z4p-a1-m2-cA (length=75) [Search sequence]
MVTAFILMVTAAGKEREVMEKLLAMPEVKEAYVVYGEYDLIVKVETDTLKDLDQFITEKI
RKMPEIQMTSTMIAI
>2z4p-a1-m2-cB (length=75) [Search sequence]
MVTAFILMVTAAGKEREVMEKLLAMPEVKEAYVVYGEYDLIVKVETDTLKDLDQFITEKI
RKMPEIQMTSTMIAI
Structure information
PDB ID 2z4p (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of FFRP-DM1
Assembly ID 1
Resolution 1.95Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 42
Sequence identity between the two chains 1.0
PubMed citation 17937921
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID A B
UniProt accession O73983 O73983
Species 70601 (Pyrococcus horikoshii OT3) 70601 (Pyrococcus horikoshii OT3)
Function annotation BioLiP:2z4pA BioLiP:2z4pB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2z4p-a1-m2-cA_2z4p-a1-m2-cB.pdb.gz
Full biological assembly
Download: 2z4p-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2cvi/1/1:A/1:B 2e1a/1/1:A/1:D 2e1a/1/1:B/1:C 2e1a/1/2:A/2:D 2e1a/1/2:B/2:C 2z4p/1/1:A/1:B 2z4p/1/1:C/1:D 2z4p/1/2:C/2:D
Other dimers with similar sequences but different poses
  • 2z4p/1/2:B/2:C 2e1a/1/1:A/1:B 2e1a/1/1:A/2:B 2e1a/1/1:B/2:A 2e1a/1/1:C/1:D 2e1a/1/2:A/2:B 2e1a/1/2:C/2:D 2z4p/1/1:A/1:D 2z4p/1/1:A/2:D 2z4p/1/1:B/1:C 2z4p/1/1:D/2:A 2z4p/1/2:A/2:D
  • 2z4p/1/2:B/2:D 2e1a/1/1:B/1:D 2e1a/1/2:B/2:D 2z4p/1/1:B/1:D
  • [Back to Home]