2z7c/2/1:C/1:D

Sequences
>2z7c-a2-m1-cC (length=89) [Search sequence]
HVVYIGKKPVMNYVLAVITQFHEGAKEVSIKARGRAISRAVDVAEIVRNRFLKDDVDVKE
IKIGTEELPTADGRTTNTSTIEIVLARKT
>2z7c-a2-m1-cD (length=92) [Search sequence]
TEEHVVYIGKKPVMNYVLAVITQFHEGAKEVSIKARGRAISRAVDVAEIVRNRFLKDDVD
VKEIKIGTEELPTADGRTTNTSTIEIVLARKT
Structure information
PDB ID 2z7c (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of chromatin protein alba from hyperthermophilic archaeon pyrococcus horikoshii
Assembly ID 2
Resolution 2.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 53
Sequence identity between the two chains 1.0
PubMed citation 18323660
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C D
UniProt accession O74101 O74101
Species 53953 (Pyrococcus horikoshii) 53953 (Pyrococcus horikoshii)
Function annotation BioLiP:2z7cC
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2z7c-a2-m1-cC_2z7c-a2-m1-cD.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 2z7c-assembly2.cif.gz
Similar dimers

[Back to Home]