2zbo/7/1:A/1:K

Sequences
>2zbo-a7-m1-cA (length=86) [Search sequence]
ADINHGENVFTANCSACHAGGNNVIMPEKTLQKDALSTNQMNSVGAITYQVTNGKNAMPA
FGGRLSDDDIEDVASFVLSQSEKSWN
>2zbo-a7-m1-cK (length=86) [Search sequence]
ADINHGENVFTANCSACHAGGNNVIMPEKTLQKDALSTNQMNSVGAITYQVTNGKNAMPA
FGGRLSDDDIEDVASFVLSQSEKSWN
Structure information
PDB ID 2zbo (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of low-redox-potential cytochrom c6 from brown alga Hizikia fusiformis at 1.6 A resolution
Assembly ID 7
Resolution 1.6Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 23
Sequence identity between the two chains 1.0
PubMed citation 18678931
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A K
UniProt accession Q76FN8 Q76FN8
Species
Function annotation BioLiP:2zboA BioLiP:2zboK
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 2zbo-a7-m1-cA_2zbo-a7-m1-cK.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 2zbo-assembly7.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2zbo/7/1:C/1:G 2zbo/7/1:E/1:I
Other dimers with similar sequences but different poses
  • 2zbo/7/1:C/1:E 2zbo/7/1:A/1:C 2zbo/7/1:A/1:E
  • 2zbo/7/1:C/1:K 2zbo/7/1:A/1:I 2zbo/7/1:E/1:G
  • 2zbo/7/1:I/1:K 2zbo/7/1:G/1:I 2zbo/7/1:G/1:K
  • [Back to Home]