2zbo/7/1:C/1:K

Sequences

>2zbo-a7-m1-cC (length=86) [Search sequence]

ADINHGENVFTANCSACHAGGNNVIMPEKTLQKDALSTNQMNSVGAITYQVTNGKNAMPA FGGRLSDDDIEDVASFVLSQSEKSWN

>2zbo-a7-m1-cK (length=86) [Search sequence]

ADINHGENVFTANCSACHAGGNNVIMPEKTLQKDALSTNQMNSVGAITYQVTNGKNAMPA FGGRLSDDDIEDVASFVLSQSEKSWN

Structure information

PDB ID	2zbo (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of low-redox-potential cytochrom c6 from brown alga Hizikia fusiformis at 1.6 A resolution
Assembly ID	7
Resolution	1.6Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	16
Sequence identity between the two chains	1.0
PubMed citation	18678931

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	K
UniProt accession	Q76FN8	Q76FN8
Species
Function annotation	BioLiP:2zboC	BioLiP:2zboK

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2zbo-a7-m1-cC_2zbo-a7-m1-cK.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 2zbo-assembly7.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2zbo/7/1:A/1:I 2zbo/7/1:E/1:G
Other dimers with similar sequences but different poses	2zbo/7/1:C/1:E 2zbo/7/1:A/1:C 2zbo/7/1:A/1:E 2zbo/7/1:A/1:K 2zbo/7/1:C/1:G 2zbo/7/1:E/1:I 2zbo/7/1:I/1:K 2zbo/7/1:G/1:I 2zbo/7/1:G/1:K