2zfc/1/1:A/1:C

Sequences
>2zfc-a1-m1-cA (length=44) [Search sequence]
VSGLVQQQNNILRALEATQHAVQALVWGVKQLQARVLALERYIK
>2zfc-a1-m1-cC (length=44) [Search sequence]
VSGLVQQQNNILRALEATQHAVQALVWGVKQLQARVLALERYIK
Structure information
PDB ID 2zfc (database links: RCSB PDB PDBe PDBj PDBsum)
Title X-ray crystal structure of an engineered N-terminal HIV-1 GP41 trimer with enhanced stability and potency
Assembly ID 1
Resolution 1.5Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 35
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A C
UniProt accession
Species
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2zfc-a1-m1-cA_2zfc-a1-m1-cC.pdb.gz
Full biological assembly
Download: 2zfc-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2zfc/1/1:A/1:B 2zfc/1/1:B/1:C

[Back to Home]