2zhp/1/1:B/1:A

Sequences

>2zhp-a1-m1-cB (length=111) [Search sequence]

AKLTSAVPVLTARDVAGAVEFWTDRLGFSRDFVEDDFAGVVRDDVTLFISAVQDQVVPDN TLAWVWVRGLDELYAEWSEVVSTPAMTEIGEQGREFALRDPAGNCVHFVAE

>2zhp-a1-m1-cA (length=120) [Search sequence]

AKLTSAVPVLTARDVAGAVEFWTDRLGFSRDFVEDDFAGVVRDDVTLFISAVQDQVVPDN TLAWVWVRGLDELYAEWSEVVSTNFRDASGPAMTEIGEQPWGREFALRDPAGNCVHFVAE

Structure information

PDB ID	2zhp (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of bleomycin-binding protein from Streptoalloteichus hindustanus complexed with bleomycin derivative
Assembly ID	1
Resolution	1.6Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	134
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	P17493	P17493
Species	2017 (Streptoalloteichus hindustanus)	2017 (Streptoalloteichus hindustanus)
Function annotation	BioLiP:2zhpB	BioLiP:2zhpA

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 2zhp-a1-m1-cB_2zhp-a1-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 2zhp-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

1byl/1/1:A/2:A 1xrk/1/1:A/1:B