2zi0/2/1:B/2:B

Sequences
>2zi0-a2-m1-cB (length=54) [Search sequence]
IEIPLHEIIRKLERNQKKQAQRKRHKLNRKERGHKSPSEQRRSELWHARQVELS
>2zi0-a2-m2-cB (length=54) [Search sequence]
IEIPLHEIIRKLERNQKKQAQRKRHKLNRKERGHKSPSEQRRSELWHARQVELS
Structure information
PDB ID 2zi0 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of Tav2b/siRNA complex
Assembly ID 2
Resolution 2.82Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 18
Sequence identity between the two chains 1.0
PubMed citation 18600235
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID B B
UniProt accession Q8UYT3 Q8UYT3
Species 12315 (Tomato aspermy virus) 12315 (Tomato aspermy virus)
Function annotation BioLiP:2zi0B BioLiP:2zi0B
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2zi0-a2-m1-cB_2zi0-a2-m2-cB.pdb.gz
Full biological assembly
Download: 2zi0-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2zi0/2/1:A/2:A 3cz3/1/1:B/1:D 3cz3/1/1:C/1:A
Other dimers with similar sequences but different poses
  • 2zi0/2/2:B/1:A 2zi0/2/1:B/2:A 3cz3/1/1:A/1:D 3cz3/1/1:C/1:B
  • [Back to Home]