2zop/3/2:E/2:F

Sequences

>2zop-a3-m2-cE (length=110) [Search sequence]

RTRSQVWAQKAYEKVREAAKGEGRGEYRDALKLPVLVRQAGLSQALAFVDSRGEAHKALG NDLAQVLGYRDLRELAEAAREAELLQYLRLTREVLAAAEWFKRFAQALIE

>2zop-a3-m2-cF (length=110) [Search sequence]

RTRSQVWAQKAYEKVREAAKGEGRGEYRDALKLPVLVRQAGLSQALAFVDSRKEAHKALG NDLAQVLGYRDLRELAEAAREAELLQYLRLTREVLAAAEWFKRFAQALIE

Structure information

PDB ID	2zop (database links: RCSB PDB PDBe PDBj PDBsum)
Title	X-ray crystal structure of a CRISPR-associated Cmr5 family protein from Thermus thermophilus HB8
Assembly ID	3
Resolution	2.1Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	15
Sequence identity between the two chains	0.991

Chain information

	Chain 1	Chain 2
Model ID	2	2
Chain ID	E	F
UniProt accession	Q53W05	Q53W05
Species	300852 (Thermus thermophilus HB8)	300852 (Thermus thermophilus HB8)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 2zop-a3-m2-cE_2zop-a3-m2-cF.pdb.gz

Full biological assembly Download: 2zop-assembly3.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2zop/1/1:C/1:A 2zop/1/1:C/1:B 2zop/2/1:D/1:E 2zop/2/1:D/1:F 2zop/2/1:E/1:F 2zop/3/1:C/1:A 2zop/3/1:C/1:B 2zop/3/2:D/2:E 2zop/3/2:D/2:F
Other dimers with similar sequences but different poses	2zop/3/1:B/2:F 2zop/3/1:C/2:E 2zop/3/2:D/1:A