2zp9/2/1:C/8:E

Sequences
>2zp9-a2-m1-cC (length=46) [Search sequence]
MVIATDDLEVACPKCERAGCPACSGKGVILTAQGYTLLDFIQKHLN
>2zp9-a2-m8-cE (length=49) [Search sequence]
MVIATDDLEVACPKCERAGGTPCPACSGKGVILTAQGYTLLDFIQKHLN
Structure information
PDB ID 2zp9 (database links: RCSB PDB PDBe PDBj PDBsum)
Title The Nature of the TRAP:Anti-TRAP complex
Assembly ID 2
Resolution 3.2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 15
Sequence identity between the two chains 1.0
PubMed citation 19164760
Chain information
Chain 1 Chain 2
Model ID 1 8
Chain ID C E
UniProt accession O31466 O31466
Species 1423 (Bacillus subtilis) 1423 (Bacillus subtilis)
Function annotation BioLiP:2zp9C BioLiP:2zp9E
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2zp9-a2-m1-cC_2zp9-a2-m8-cE.pdb.gz
Full biological assembly
Download: 2zp9-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2zp9/2/4:C/6:E 2zp9/2/5:C/7:E
Other dimers with similar sequences but different poses
  • 2zp9/2/8:C/8:E 2zp9/1/1:J/1:H 2zp9/1/1:O/1:M 2zp9/1/2:J/2:H 2zp9/1/2:O/2:M 2zp9/1/3:J/3:H 2zp9/1/3:O/3:M 2zp9/2/1:C/1:E 2zp9/2/1:D/1:C 2zp9/2/1:D/1:E 2zp9/2/4:C/4:E 2zp9/2/4:D/4:C 2zp9/2/4:D/4:E 2zp9/2/5:C/5:E 2zp9/2/5:D/5:C 2zp9/2/5:D/5:E 2zp9/2/6:C/6:E 2zp9/2/6:D/6:C 2zp9/2/6:D/6:E 2zp9/2/7:C/7:E 2zp9/2/7:D/7:C 2zp9/2/7:D/7:E 2zp9/2/8:D/8:C 2zp9/2/8:D/8:E
  • [Back to Home]