2zw7/1/1:A/1:B

Sequences

>2zw7-a1-m1-cA (length=290) [Search sequence]

TAHLRTARLELTPLDPAADARHLHHAYGDEEVRWWTRPACADPAETERYLTSCAAAPGAR
LWTIRAPDGTVPGAGLLGGTDVPGLTWLLRRDSWGHGYATEAAAAVVGHALEDGGLDRVE
AWIEAGNRRSLAVAARVGLTERARLAQHYPHRPGPHEVVLGKARAEEPLTTLAVITELPV
RDVAATLRLVEAALGARTAFAIGDPPEFAEAALTPWSAGPRFRLAAVPGPGPVEPVRLHL
DAAGTADSLHRRAVDAGARVDGPPVRRPWGRSEFVITLPEGHELTVSAPV

>2zw7-a1-m1-cB (length=290) [Search sequence]

Structure information

PDB ID	2zw7 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of bleomycin N-acetyltransferase complexed with bleomycin A2 and coenzyme A
Assembly ID	1
Resolution	2.8Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	188
Sequence identity between the two chains	1.0
PubMed citation	19889644

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	Q53796	Q53796
Species	29309 (Streptomyces verticillus)	29309 (Streptomyces verticillus)
Function annotation	BioLiP:2zw7A	BioLiP:2zw7B

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	2zw7-a1-m1-cA_2zw7-a1-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	2zw7-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

2zw4/1/1:A/1:B 2zw4/2/1:C/1:D 2zw5/1/1:A/1:B 2zw6/1/1:B/1:A