2zwk/1/2:B/4:B

Sequences

>2zwk-a1-m2-cB (length=63) [Search sequence]

ATETATRDQLTKEAFQNPDNQKVNIDELGNAIPSGVLKDDVVANIEEQAKAAGEEAKQQA IEN

>2zwk-a1-m4-cB (length=63) [Search sequence]

ATETATRDQLTKEAFQNPDNQKVNIDELGNAIPSGVLKDDVVANIEEQAKAAGEEAKQQA IEN

Structure information

PDB ID	2zwk (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of intimin-Tir90 complex
Assembly ID	1
Resolution	3.1Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	64
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	2	4
Chain ID	B	B
UniProt accession	Q7DB77	Q7DB77
Species	155864 (Escherichia coli O157:H7 str. EDL933)	155864 (Escherichia coli O157:H7 str. EDL933)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 2zwk-a1-m2-cB_2zwk-a1-m4-cB.pdb.gz

Full biological assembly Download: 2zwk-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2zqk/1/1:N/1:M 2zqk/2/1:D/1:C 2zqk/5/1:N/1:M 2zqk/6/1:D/1:C 2zwk/1/1:B/3:B 2zwk/2/1:D/5:D 2zwk/2/1:F/5:F
Other dimers with similar sequences but different poses	2zwk/2/1:D/5:F 2zwk/1/1:B/4:B 2zwk/1/2:B/3:B 2zwk/2/1:F/5:D