2zyq/1/1:A/1:B

Sequences

>2zyq-a1-m1-cA (length=296) [Search sequence]

SIRSLGYLRIEATDMAAWREYGLKVLGMVEGKGAPEGALYLRMDDFPARLVVVPGEHDRL
LEAGWECANAEGLQEIRNRLDLEGTPYKEATAAELADRRVDEMIRFADPSGNCLEVFHGT
ALEHRRVVSPYGHRFVTGEQGMGHVVLSTRDDAEALHFYRDVLGFRLRDSMRLPPQMVGR
PADGPPAWLRFFGCNPRHHSLAFLPMPTSSGIVHLMVEVEQADDVGLCLDRALRRKVPMS
ATLGRHVNDLMLSFYMKTPGGFDIEFGCEGRQVDDRDWIARESTAVSLWGHDFTVG

>2zyq-a1-m1-cB (length=296) [Search sequence]

Structure information

PDB ID	2zyq (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the HsaC extradiol dioxygenase from M. tuberculosis
Assembly ID	1
Resolution	2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	32
Sequence identity between the two chains	1.0
PubMed citation	19300498

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	P9WNW7	P9WNW7
Species	1773 (Mycobacterium tuberculosis)	1773 (Mycobacterium tuberculosis)
Function annotation	BioLiP:2zyqA	BioLiP:2zyqB

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	2zyq-a1-m1-cA_2zyq-a1-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	2zyq-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2zi8/1/1:B/1:A 2zi8/1/2:B/2:A 2zi8/1/3:B/3:A 2zi8/1/4:B/4:A
Other dimers with similar sequences but different poses	2zi8/1/2:B/4:B 2zi8/1/1:A/3:A 2zi8/1/1:A/4:A 2zi8/1/1:B/3:B 2zi8/1/1:B/4:B 2zi8/1/2:A/3:A 2zi8/1/2:A/4:A 2zi8/1/2:B/3:B 2zi8/1/4:B/1:A 2zi8/1/1:B/3:A 2zi8/1/2:B/4:A 2zi8/1/3:B/2:A