2zzd/1/1:E/1:B

Sequences
>2zzd-a1-m1-cE (length=151) [Search sequence]
SIREEVHRHLGTVALMQPALHQQTHAPAPTEITHTLFRAYTRVPHDVGGEADVPIEYHEK
EEEIWELNTFATCECLAWRGVWTAEERRRKQNCDVGQTVYLGMPYYGRWLLTAARILVDK
QFVTLTELHNKIVEMRERVASGQGLGEYLPP
>2zzd-a1-m1-cB (length=153) [Search sequence]
SSIREEVHRHLGTVALMQPALHQQTHAPAPTEITHTLFRAYTRVPHDVGGEADVPIEYHE
KEEEIWELNTFATCECLAWRGVWTAEERRRKQNCDVGQTVYLGMPYYGRWLLTAARILVD
KQFVTLTELHNKIVEMRERVASGQGLGEYLPPK
Structure information
PDB ID 2zzd (database links: RCSB PDB PDBe PDBj PDBsum)
Title Recombinant thiocyanate hydrolase, air-oxidized form of holo-enzyme
Assembly ID 1
Resolution 1.78Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 71
Sequence identity between the two chains 1.0
PubMed citation 19785438
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID E B
UniProt accession O66186 O66186
Species 931 (Thiobacillus thioparus) 931 (Thiobacillus thioparus)
Function annotation BioLiP:2zzdB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 2zzd-a1-m1-cE_2zzd-a1-m1-cB.pdb.gz
Full biological assembly
Download: 2zzd-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2dd4/1/1:E/1:B 2dd4/1/1:K/1:H 2dd5/1/1:E/1:B 2dd5/1/1:K/1:H 2dxb/1/1:E/1:B 2dxb/1/1:K/1:H 2dxb/2/1:Q/1:N 2dxb/2/1:W/1:T 2dxc/1/1:E/1:B 2dxc/1/1:K/1:H 2zzd/1/1:K/1:H 3vyg/1/1:E/1:K 3vyg/1/1:H/1:B
Other dimers with similar sequences but different poses
  • 2zzd/1/1:E/1:K 2dd4/1/1:B/1:H 2dd4/1/1:E/1:K 2dd5/1/1:B/1:H 2dd5/1/1:E/1:K 2dxb/1/1:B/1:H 2dxb/1/1:E/1:K 2dxb/2/1:N/1:T 2dxb/2/1:Q/1:W 2dxc/1/1:B/1:H 2dxc/1/1:E/1:K 2zzd/1/1:B/1:H 3vyg/1/1:E/1:B 3vyg/1/1:H/1:K
  • 2dxc/1/1:B/1:K 2dd4/1/1:B/1:K 2dd4/1/1:E/1:H 2dd5/1/1:B/1:K 2dd5/1/1:E/1:H 2dxb/1/1:B/1:K 2dxb/1/1:E/1:H 2dxb/2/1:N/1:W 2dxb/2/1:Q/1:T 2dxc/1/1:E/1:H 2zzd/1/1:E/1:H 2zzd/1/1:K/1:B 3vyg/1/1:E/1:H 3vyg/1/1:K/1:B
    		•

    [Back to Home]