3a0e/1/1:A/2:A

Sequences
>3a0e-a1-m1-cA (length=110) [Search sequence]
VNSLSSPNSLFTGHSLEVGPSYRLIMQGDCNFVLYDSGKPVWASNTGGLGSGCRLTLHNN
GNLVIYDQSNRVIWQTKTNGKEDHYVLVLQQDRNVVIYGPVVWATGSGPA
>3a0e-a1-m2-cA (length=110) [Search sequence]
VNSLSSPNSLFTGHSLEVGPSYRLIMQGDCNFVLYDSGKPVWASNTGGLGSGCRLTLHNN
GNLVIYDQSNRVIWQTKTNGKEDHYVLVLQQDRNVVIYGPVVWATGSGPA
Structure information
PDB ID 3a0e (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of Polygonatum cyrtonema lectin (PCL) complexed with dimannoside
Assembly ID 1
Resolution 2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 146
Sequence identity between the two chains 1.0
PubMed citation 20546901
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession Q8L568 Q8L568
Species 195526 (Polygonatum cyrtonema) 195526 (Polygonatum cyrtonema)
Function annotation BioLiP:3a0eA BioLiP:3a0eA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3a0e-a1-m1-cA_3a0e-a1-m2-cA.pdb.gz
Full biological assembly
Download: 3a0e-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3a0c/1/1:A/1:B 3a0c/2/1:C/1:D 3a0d/1/1:A/2:A

[Back to Home]