3a1m/1/1:F/1:C

Sequences
>3a1m-a1-m1-cF (length=85) [Search sequence]
EGNGTILVKGNVTIIVEGNADITVKGDATTLVEGNQTNTVNGNLSWKVAGTVDWDVGGDW
TEKMASMSSISSGQYTIDGSRIDIG
>3a1m-a1-m1-cC (length=111) [Search sequence]
GNGTILVKGNVTIIVEGNADITVKGDATTLVEGNQTNTVNGNLSWKVAGTVDWDVGGDWT
EKMASMSSISSGQYTIDGSRIDIGSVEGYIPEAPRDGQAYVRKDGEWVFLS
Structure information
PDB ID 3a1m (database links: RCSB PDB PDBe PDBj PDBsum)
Title A fusion protein of a beta helix region of gene product 5 and the foldon region of bacteriophage T4
Assembly ID 1
Resolution 2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 43
Sequence identity between the two chains 0.988
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID F C
UniProt accession P10104 P10104
Species 10665 (Tequatrovirus T4) 10665 (Tequatrovirus T4)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3a1m-a1-m1-cF_3a1m-a1-m1-cC.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3a1m-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3a1m/1/1:D/1:A 3a1m/1/1:D/1:B 3a1m/1/1:E/1:A 3a1m/1/1:E/1:C 3a1m/1/1:F/1:B
Other dimers with similar sequences but different poses
  • 3a1m/1/1:C/1:A 3a1m/1/1:A/1:B 3a1m/1/1:C/1:B
  • [Back to Home]