3a1y/1/1:D/1:E

Sequences
>3a1y-a1-m1-cD (length=58) [Search sequence]
MEYVYAALLLHSVGKEINEENLKAVLQAAGVEPEEARIKALVAALEGVNIDEVIEKAA
>3a1y-a1-m1-cE (length=58) [Search sequence]
MEYVYAALLLHSVGKEINEENLKAVLQAAGVEPEEARIKALVAALEGVNIDEVIEKAA
Structure information
PDB ID 3a1y (database links: RCSB PDB PDBe PDBj PDBsum)
Title The structure of archaeal ribosomal stalk P1/P0 complex
Assembly ID 1
Resolution 2.13Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 17
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D E
UniProt accession O57705 O57705
Species 53953 (Pyrococcus horikoshii) 53953 (Pyrococcus horikoshii)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3a1y-a1-m1-cD_3a1y-a1-m1-cE.pdb.gz
Full biological assembly
Download: 3a1y-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 3a1y/1/1:E/1:F 3a1y/1/1:A/1:B 3a1y/1/1:C/1:D
  • [Back to Home]