3a2a/2/1:C/1:D

Sequences

>3a2a-a2-m1-cC (length=41) [Search sequence]

RQLLRLKQMNVQLAAKIQHLEFSCSEKEQEIERLNKLLRQH

>3a2a-a2-m1-cD (length=41) [Search sequence]

RQLLRLKQMNVQLAAKIQHLEFSCSEKEQEIERLNKLLRQH

Structure information

PDB ID	3a2a (database links: RCSB PDB PDBe PDBj PDBsum)
Title	The structure of the carboxyl-terminal domain of the human voltage-gated proton channel Hv1
Assembly ID	2
Resolution	2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	55
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	D
UniProt accession	Q96D96	Q96D96
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3a2a-a2-m1-cC_3a2a-a2-m1-cD.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3a2a-assembly2.cif.gz

Similar dimers