3a5u/1/2:B/2:A

Sequences

>3a5u-a1-m2-cB (length=112) [Search sequence]

MAGDTTITVVGNLTADPELRFTPSGAAVANFTVASTPRMGEWKDGEALFLRCNIWREAAE NVAESLTRGSRVIVTGRLKQRSFETREKRTVVEVEVDEIGPSLRYATAKVNK

>3a5u-a1-m2-cA (length=118) [Search sequence]

MAGDTTITVVGNLTADPELRFTPSGAAVANFTVASTPRMFDRQSGEWKDGEALFLRCNIW REAAENVAESLTRGSRVIVTGRLKQRSFTREGEKRTVVEVEVDEIGPSLRYATAKVNK

Structure information

PDB ID	3a5u (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Promiscuity and specificity in DNA binding to SSB: Insights from the structure of the Mycobacterium smegmatis SSB-ssDNA complex
Assembly ID	1
Resolution	2.8Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	73
Sequence identity between the two chains	0.991
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	2	2
Chain ID	B	A
UniProt accession	Q9AFI5	Q9AFI5
Species	246196 (Mycolicibacterium smegmatis MC2 155)	246196 (Mycolicibacterium smegmatis MC2 155)
Function annotation	BioLiP:3a5uB	BioLiP:3a5uA

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 3a5u-a1-m2-cB_3a5u-a1-m2-cA.pdb.gz

Full biological assembly Download: 3a5u-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

1ue1/1/1:A/2:A 1ue5/1/1:A/2:A 1x3e/1/1:B/2:B 1x3g/1/1:A/2:A 3a5u/1/1:B/1:A 3afp/1/1:B/2:B 7f5y/1/2:A/1:B