3abf/1/1:E/1:C

Sequences
>3abf-a1-m1-cE (length=61) [Search sequence]
MVVLKVTLLEGRPPEKKRELVRRLTEMASRLLGEPYEEVRVILYEVRRDQWAAGGVLFSD
K
>3abf-a1-m1-cC (length=63) [Search sequence]
MVVLKVTLLEGRPPEKKRELVRRLTEMASRLLGEPYEEVRVILYEVRRDQWAAGGVLFSD
KEG
Structure information
PDB ID 3abf (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of a 4-Oxalocrotonate Tautomerase Homologue (TTHB242)
Assembly ID 1
Resolution 1.94Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 42
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID E C
UniProt accession Q53WI4 Q53WI4
Species 300852 (Thermus thermophilus HB8) 300852 (Thermus thermophilus HB8)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3abf-a1-m1-cE_3abf-a1-m1-cC.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3abf-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3abf/1/1:B/1:F 3abf/1/1:C/1:A 3abf/1/1:D/1:B 3abf/1/1:D/1:F 3abf/1/1:E/1:A
Other dimers with similar sequences but different poses
  • 3abf/1/1:D/1:C 3abf/1/1:B/1:A 3abf/1/1:E/1:F
  • [Back to Home]