3abf/1/1:E/1:C

Sequences

>3abf-a1-m1-cE (length=61) [Search sequence]

MVVLKVTLLEGRPPEKKRELVRRLTEMASRLLGEPYEEVRVILYEVRRDQWAAGGVLFSD K

>3abf-a1-m1-cC (length=63) [Search sequence]

MVVLKVTLLEGRPPEKKRELVRRLTEMASRLLGEPYEEVRVILYEVRRDQWAAGGVLFSD KEG

Structure information

PDB ID	3abf (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of a 4-Oxalocrotonate Tautomerase Homologue (TTHB242)
Assembly ID	1
Resolution	1.94Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	42
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	E	C
UniProt accession	Q53WI4	Q53WI4
Species	300852 (Thermus thermophilus HB8)	300852 (Thermus thermophilus HB8)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3abf-a1-m1-cE_3abf-a1-m1-cC.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3abf-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	3abf/1/1:B/1:F 3abf/1/1:C/1:A 3abf/1/1:D/1:B 3abf/1/1:D/1:F 3abf/1/1:E/1:A
Other dimers with similar sequences but different poses	3abf/1/1:D/1:C 3abf/1/1:B/1:A 3abf/1/1:E/1:F