3apy/4/1:G/1:H

Sequences

>3apy-a4-m1-cG (length=291) [Search sequence]

MKIRDLLKARRGPLFSFEFFPPKDPEGEEALFRTLEELKAFRPAFVSITYGAMGSTRERS
VAWAQRIQSLGLNPLAHLTVAGQSRKEVAEVLHRFVESGVENLLALRGDPPRGERVFRPH
PEGFRYAAELVALIRERYGDRVSVGGAAYPEGHPESESLEADLRHFKAKVEAGLDFAITQ
LFFNNAHYFGFLERARRAGIGIPILPGIMPVTSYRQLRRFTEVCGASIPGPLLAKLERHQ
DDPKAVLEIGVEHAVRQVAELLEAGVEGVHFYTLNKSPATRMVLERLGLRP

>3apy-a4-m1-cH (length=291) [Search sequence]

Structure information

PDB ID	3apy (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Properties and crystal structure of methylenetetrahydrofolate reductase from Thermus thermophilus HB8
Assembly ID	4
Resolution	2.8Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	106
Sequence identity between the two chains	1.0
PubMed citation	21858212

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	G	H
UniProt accession	Q5SLG6	Q5SLG6
Species	300852 (Thermus thermophilus HB8)	300852 (Thermus thermophilus HB8)
Function annotation	BioLiP:3apyG	BioLiP:3apyH

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3apy-a4-m1-cG_3apy-a4-m1-cH.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3apy-assembly4.cif.gz

Similar dimers

Other dimers with similar sequences and structures	3apy/1/1:A/1:B 3apy/2/1:C/1:D 3apy/3/1:E/1:F 7th5/1/1:B/1:A
Other dimers with similar sequences but different poses	7th4/1/1:A/1:B 3apt/1/1:B/1:A 8eac/1/1:B/1:A