3aud/4/1:A/2:B

Sequences
>3aud-a4-m1-cA (length=56) [Search sequence]
RPAFCLEPPYAGPGKARIIRYFYNAAAGAAQTFVYGGVRAKRNNFASAADALAACA
>3aud-a4-m2-cB (length=56) [Search sequence]
RPAFCLEPPYAGPGKARIIRYFYNAAAGAAQTFVYGGVRAKRNNFASAADALAACA
Structure information
PDB ID 3aud (database links: RCSB PDB PDBe PDBj PDBsum)
Title Simplified BPTI variant with poly Asn amino acid tag (C5N) at the C-terminus
Assembly ID 4
Resolution 1.943Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 24
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A B
UniProt accession
Species 9913 (Bos taurus) 9913 (Bos taurus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3aud-a4-m1-cA_3aud-a4-m2-cB.pdb.gz
Full biological assembly
Download: 3aud-assembly4.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3aud/4/1:A/2:C 3aud/4/1:B/1:C 3aud/4/1:B/2:A 3aud/4/2:A/1:C 3aud/4/2:B/2:C
Other dimers with similar sequences but different poses
  • 3aud/4/2:A/2:B 3aud/4/1:A/1:B 3aud/4/1:C/2:C
  • 3ci7/1/1:B/1:D 3ci7/1/1:A/1:C
  • 3ci7/1/1:D/1:C 3ci7/1/1:B/1:A
  • [Back to Home]