3axg/2/1:E/1:F

Sequences

>3axg-a2-m1-cE (length=344) [Search sequence]

VHALTDIDGGIAVDPAPRLAGPPVFGGPGNDAFDLAPVRSTGREMLRFDFPGVSIGAAHY
EEGPTGATVIHIPAGARTAVDARGGAVGLSGGYDFNHAICLAGGASYGLEAGAGVSGALL
ERLEYRTGFAEAQLVSSAVIYDFSARSTAVYPDKALGRAALEFAVPGEFPQGRAGAGMSA
SAGKVDWDRTEITGQGAAFRRLGDVRILAVVVPNPVGVIMDRAGTVVRGNYDAQTGVRRH
PVFDYQEAFAEQVPPTTISAIVTNVRMSPVELNQFAKQVHSSMHRGIQPFHTDMDGDTLF
AVTTDEIDLPTTPGSSRGRLSVNATALGAIASEVMWDAVLEAGK

>3axg-a2-m1-cF (length=344) [Search sequence]

Structure information

PDB ID	3axg (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of 6-aminohexanoate-oligomer hydrolase
Assembly ID	2
Resolution	2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	104
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	E	F
UniProt accession	Q1EPR5	Q1EPR5
Species	388924 (Agromyces sp. KY5R)	388924 (Agromyces sp. KY5R)

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3axg-a2-m1-cE_3axg-a2-m1-cF.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3axg-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures	3axg/1/1:A/1:D 3axg/1/1:B/1:C 3axg/2/1:G/1:H 3axg/3/1:I/1:J 3axg/3/1:K/1:L 3axg/4/1:M/1:N 3axg/4/2:M/2:N 3axg/5/1:O/3:O 3axg/5/2:O/4:O 5xyg/1/1:A/1:B 5xyo/1/1:B/1:A 5xyo/1/2:B/2:A 5xyp/1/1:B/1:A 5xyp/1/2:B/2:A 5xyq/1/1:B/1:A 5xyq/1/2:B/2:A 5xys/1/1:A/1:B 5xys/1/2:A/2:B 5xyt/1/1:A/1:B 5xyt/1/2:A/2:B 5y0l/1/1:A/1:B 5y0m/1/1:A/1:B 5y0m/1/2:A/2:B 7yu0/1/1:A/1:B 7yu1/1/1:A/1:B 7yu2/1/1:A/1:B
Other dimers with similar sequences but different poses	3axg/3/1:J/1:L 3axg/1/1:A/1:B 3axg/1/1:C/1:D 3axg/2/1:E/1:G 3axg/2/1:F/1:H 3axg/3/1:K/1:I 3axg/4/1:M/2:N 3axg/4/1:N/2:M 3axg/5/1:O/4:O 3axg/5/2:O/3:O 5xyo/1/1:A/2:A 5xyo/1/1:B/2:B 5xyp/1/1:A/2:A 5xyp/1/1:B/2:B 5xyq/1/1:A/2:A 5xyq/1/1:B/2:B 5xys/1/1:A/2:A 5xys/1/1:B/2:B 5xyt/1/1:A/2:A 5xyt/1/1:B/2:B 5y0m/1/1:A/2:A 5y0m/1/1:B/2:B