3axm/1/1:X/1:Z

Sequences

>3axm-a1-m1-cX (length=122) [Search sequence]

MQVWPIEGIKKFETLSYLPPLTVEDLLKQIEYLLRSKWVPCLEFSKVGFVYRENHRSPGY YDGRYWTMWKLPMFGCTDATQVLKELEEAKKAYPDAFVRIIGFDNVRQVQLISFIAYKPP GC

>3axm-a1-m1-cZ (length=122) [Search sequence]

MQVWPIEGIKKFETLSYLPPLTVEDLLKQIEYLLRSKWVPCLEFSKVGFVYRENHRSPGY YDGRYWTMWKLPMFGCTDATQVLKELEEAKKAYPDAFVRIIGFDNVRQVQLISFIAYKPP GC

Structure information

PDB ID	3axm (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of rice Rubisco in complex with 6PG
Assembly ID	1
Resolution	1.65Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	13
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	X	Z
UniProt accession	Q0INY7	Q0INY7
Species	39947 (Oryza sativa Japonica Group)	39947 (Oryza sativa Japonica Group)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3axm-a1-m1-cX_3axm-a1-m1-cZ.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3axm-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

1wdd/1/1:S/3:S 1wdd/1/1:S/4:S 1wdd/1/1:W/3:W 1wdd/1/1:W/4:W 1wdd/1/2:S/3:S 1wdd/1/2:S/4:S 1wdd/1/2:W/3:W 1wdd/1/2:W/4:W 3axk/1/1:S/3:S 3axk/1/1:S/4:S 3axk/1/1:T/3:T 3axk/1/1:T/4:T 3axk/1/2:S/3:S 3axk/1/2:S/4:S 3axk/1/2:T/3:T 3axk/1/2:T/4:T 3axm/1/1:S/1:U 3axm/1/1:S/1:Y 3axm/1/1:T/1:V 3axm/1/1:T/1:Z 3axm/1/1:U/1:W 3axm/1/1:V/1:X 3axm/1/1:W/1:Y 6kyi/1/1:S/3:S 6kyi/1/1:S/4:S 6kyi/1/1:T/3:T 6kyi/1/1:T/4:T 6kyi/1/2:S/3:S 6kyi/1/2:S/4:S 6kyi/1/2:T/3:T 6kyi/1/2:T/4:T