3ayt/6/1:B/1:D

Sequences

>3ayt-a6-m1-cB (length=240) [Search sequence]

MDVRLAFPLSRAEEALPRLQALGLGAEVYLDPALLEEDALFQSLRRRFSGKLSVHLPFWN
LDLLSPDPEVRGLTLRRLLFGLDRAAELGADRAVFHSGIPHGRTPEEALERALPLAEALG
LVVRRARTLGVRLLLENSHEPHPEALRPVLEAHAGELGFCFDAAHARVFSRTPDPGPWLA
LAPEHLHLNDTDGVYDRHWNLGRGVLGHGAWLRPYLDRTMVLEVREDPEASLAFLQALAG

>3ayt-a6-m1-cD (length=240) [Search sequence]

Structure information

PDB ID	3ayt (database links: RCSB PDB PDBe PDBj PDBsum)
Title	TTHB071 protein from Thermus thermophilus HB8
Assembly ID	6
Resolution	1.95Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	72
Sequence identity between the two chains	1.0
PubMed citation	21984829

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	D
UniProt accession	Q53W91	Q53W91
Species	300852 (Thermus thermophilus HB8)	300852 (Thermus thermophilus HB8)
Function annotation	BioLiP:3aytB	BioLiP:3aytD

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3ayt-a6-m1-cB_3ayt-a6-m1-cD.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3ayt-assembly6.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3ayt/5/1:A/1:C 3ayv/5/1:A/1:D 3ayv/6/1:C/1:B