3b4s/1/2:B/3:B

Sequences
>3b4s-a1-m2-cB (length=88) [Search sequence]
DGRIFKFIEHLEFEKGLDAFSQSWIKALEDSEFLAILRLLFHHIVTSESAHEFAANGIDR
LYKVESQFGSGGDKELEWLIGRSLIQSK
>3b4s-a1-m3-cB (length=88) [Search sequence]
DGRIFKFIEHLEFEKGLDAFSQSWIKALEDSEFLAILRLLFHHIVTSESAHEFAANGIDR
LYKVESQFGSGGDKELEWLIGRSLIQSK
Structure information
PDB ID 3b4s (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of a LuxT domain from Vibrio parahaemolyticus RIMD 2210633
Assembly ID 1
Resolution 3.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 60
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 3
Chain ID B B
UniProt accession Q87J33 Q87J33
Species 223926 (Vibrio parahaemolyticus RIMD 2210633) 223926 (Vibrio parahaemolyticus RIMD 2210633)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3b4s-a1-m2-cB_3b4s-a1-m3-cB.pdb.gz
Full biological assembly
Download: 3b4s-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3b4s/1/1:B/2:B 3b4s/1/1:B/3:B 3b4s/2/1:D/1:F 3b4s/2/1:D/1:H 3b4s/2/1:F/1:H
Other dimers with similar sequences but different poses
  • 3b4s/1/2:A/3:A 3b4s/1/1:A/2:A 3b4s/1/1:A/3:A 3b4s/2/1:E/1:C 3b4s/2/1:E/1:G 3b4s/2/1:G/1:C
  • 3b4s/1/3:B/3:A 3b4s/1/1:B/1:A 3b4s/1/2:B/2:A 3b4s/2/1:D/1:C 3b4s/2/1:F/1:E 3b4s/2/1:H/1:G
  • 3b4s/1/3:B/2:A 3b4s/1/1:B/3:A 3b4s/1/2:B/1:A 3b4s/2/1:D/1:E 3b4s/2/1:F/1:G 3b4s/2/1:H/1:C
  • 3b4s/2/1:H/1:E 3b4s/2/1:F/1:C
    		•

    [Back to Home]