3b59/1/1:E/1:F

Sequences

>3b59-a1-m1-cE (length=294) [Search sequence]

LSRVTEIRYVGYGVKDFDAEKAFYADVWGLEPVGEDANNAWFKAQGADEHHVVQLRRADE
NRIDVIALAADSRSDVDALRASVEAAGCKVASEPAVLATPGGGYGFRFFSPDGLLFEVSS
DVAKGAKRDLARWEGVPVKISHIVLHSPNHQDVKFFTDVLGFKVSDWLGDFCFLRCNSAH
HRIAILPGPPCLNHVAYDLSVDDRGAHRLKVKGIDIGWGPGRHTAGNNTFSYFVTPGGFV
TEYTSELEEVDFDTHQYKVHVPAPVDQWGIGTGGPQTLPHPHANPGLFQTAEAE

>3b59-a1-m1-cF (length=294) [Search sequence]

Structure information

PDB ID	3b59 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the Mn(II)-bound glyoxalase from Novosphingobium aromaticivorans
Assembly ID	1
Resolution	2.53Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	28
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	E	F
UniProt accession	Q2GAG3	Q2GAG3
Species	279238 (Novosphingobium aromaticivorans DSM 12444)	279238 (Novosphingobium aromaticivorans DSM 12444)
Function annotation	BioLiP:3b59E	BioLiP:3b59F

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3b59-a1-m1-cE_3b59-a1-m1-cF.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3b59-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	3b59/1/1:A/1:B 3b59/1/1:C/1:D
Other dimers with similar sequences but different poses	3b59/1/1:D/1:F 3b59/1/1:A/1:C 3b59/1/1:B/1:E 3b59/1/1:C/1:F 3b59/1/1:A/1:D 3b59/1/1:A/1:E 3b59/1/1:B/1:F 3b59/1/1:D/1:E