3bb6/1/1:D/1:A

Sequences

>3bb6-a1-m1-cD (length=100) [Search sequence]

LQIPQNYIHTRSTPFWNKQTAPAGIFERHLDKGTRPGVYPRLSVHGAVKYLGYADEHSAE PDQVILIEAGQFAVFPPEKWHNIEATDDTYFNIDFFVAPE

>3bb6-a1-m1-cA (length=105) [Search sequence]

LQIPQNYIHTRSTPFWNKQTAPAGIFERHLDKGTRPGVYPRLSVHGAVKYLGYADEHSAE PDQVILIEAGQFAVFPPEKWHNIEATDDTYFNIDFFVAPEVLEGA

Structure information

PDB ID	3bb6 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the P64488 protein from E.coli (strain K12). Northeast Structural Genomics Consortium target ER596
Assembly ID	1
Resolution	2.3Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	39
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	A
UniProt accession	P64488	P64488
Species	83333 (Escherichia coli K-12)	83333 (Escherichia coli K-12)
Function annotation	BioLiP:3bb6D	BioLiP:3bb6A

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 3bb6-a1-m1-cD_3bb6-a1-m1-cA.pdb.gz

Full biological assembly Download: 3bb6-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

3bb6/3/1:D/1:B 3bb6/1/1:A/1:C 3bb6/1/1:D/1:B 3bb6/2/1:A/1:C