3bb6/3/1:D/1:B

Sequences

>3bb6-a3-m1-cD (length=100) [Search sequence]

LQIPQNYIHTRSTPFWNKQTAPAGIFERHLDKGTRPGVYPRLSVHGAVKYLGYADEHSAE PDQVILIEAGQFAVFPPEKWHNIEATDDTYFNIDFFVAPE

>3bb6-a3-m1-cB (length=107) [Search sequence]

LQIPQNYIHTRSTPFWNKQTAPAGIFERHLDKGTRPGVYPRLSVHGAVKYLGYADEHSAE PDQVILIEAGQFAVFPPEKWHNIEATDDTYFNIDFFVAPEVLEGAQQ

Structure information

PDB ID	3bb6 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the P64488 protein from E.coli (strain K12). Northeast Structural Genomics Consortium target ER596
Assembly ID	3
Resolution	2.3Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	44
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	B
UniProt accession	P64488	P64488
Species	83333 (Escherichia coli K-12)	83333 (Escherichia coli K-12)
Function annotation	BioLiP:3bb6D	BioLiP:3bb6B

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3bb6-a3-m1-cD_3bb6-a3-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3bb6-assembly3.cif.gz

Similar dimers

Other dimers with similar sequences and structures	3bb6/1/1:A/1:C 3bb6/1/1:D/1:B 3bb6/2/1:A/1:C
Other dimers with similar sequences but different poses	3bb6/1/1:D/1:A 3bb6/1/1:B/1:C