3bb9/3/1:F/1:E

Sequences
>3bb9-a3-m1-cF (length=115) [Search sequence]
DSAAGNVVKQFHAALQGNEAIVRQSLAANVQIYEGGKVERSLTEYANHHLADAYLKGLTI
TPKEHQITITGDIAISTSISHAQGEYKGKSIDSTETLVLIKQADGRWKITHVHWS
>3bb9-a3-m1-cE (length=120) [Search sequence]
AFIGVDSAAGNVVKQFHAALQGNEAIVRQSLAANVQIYEGGKVERSLTEYANHHLADAYL
KGLTITPKEHQITITGDIAISTSISHAQGEYKGKSIDSTETLVLIKQADGRWKITHVHWS
Structure information
PDB ID 3bb9 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of a putative ketosteroid isomerase (sfri_1973) from shewanella frigidimarina ncimb 400 at 1.80 A resolution
Assembly ID 3
Resolution 1.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 63
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID F E
UniProt accession Q082J6 Q082J6
Species 318167 (Shewanella frigidimarina NCIMB 400) 318167 (Shewanella frigidimarina NCIMB 400)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3bb9-a3-m1-cF_3bb9-a3-m1-cE.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3bb9-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3bb9/1/1:A/1:B 3bb9/2/1:C/1:D

[Back to Home]