3bbz/3/1:A/2:B

Sequences
>3bbz-a3-m1-cA (length=48) [Search sequence]
GQKVMITKMITDSVANPQMKQAFEQRLAKASTEDALNDIKRDIIRSAI
>3bbz-a3-m2-cB (length=48) [Search sequence]
GQKVMITKMITDSVANPQMKQAFEQRLAKASTEDALNDIKRDIIRSAI
Structure information
PDB ID 3bbz (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of the nucleocapsid-binding domain from the mumps virus phosphoprotein
Assembly ID 3
Resolution 2.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 37
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A B
UniProt accession Q9J4L6 Q9J4L6
Species
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3bbz-a3-m1-cA_3bbz-a3-m2-cB.pdb.gz
Full biological assembly
Download: 3bbz-assembly3.cif.gz

[Back to Home]