3bd1/2/1:C/1:A

Sequences

>3bd1-a2-m1-cC (length=64) [Search sequence]

MNAIDIAINKLGSVSALAASLGVRQSAISNWRARGRVPAERCIDIERVTNGAVICRELRP DVFG

>3bd1-a2-m1-cA (length=65) [Search sequence]

MNAIDIAINKLGSVSALAASLGVRQSAISNWRARGRVPAERCIDIERVTNGAVICRELRP DVFGA

Structure information

PDB ID	3bd1 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of the Cro protein from putative prophage element Xfaso 1 in Xylella fastidiosa strain Ann-1
Assembly ID	2
Resolution	1.4Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	36
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	A
UniProt accession
Species	155920 (Xylella fastidiosa subsp. sandyi Ann-1)	155920 (Xylella fastidiosa subsp. sandyi Ann-1)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3bd1-a2-m1-cC_3bd1-a2-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3bd1-assembly2.cif.gz