3bd5/3/1:A/1:B

Sequences

>3bd5-a3-m1-cA (length=112) [Search sequence]

LVMSQSPSSLAVSAGEKVTMSCKSSQSLFNSRTRKNYLAWYQQKPGQSPKLLIYWASTRE SGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCKQSYYHMYTFGSGTKLEIK

>3bd5-a3-m1-cB (length=112) [Search sequence]

LVMSQSPSSLAVSAGEKVTMSCKSSQSLFNSRTRKNYLAWYQQKPGQSPKLLIYWASTRE SGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCKQSYYHMYTFGSGTKLEIK

Structure information

PDB ID	3bd5 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of single domain VL of an anti-DNA binding antibody 3D8 scFv and its active site revealed by complex structures of a small molecule and metals
Assembly ID	3
Resolution	2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	43
Sequence identity between the two chains	1.0
PubMed citation	18338383

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession
Species	10090 (Mus musculus)	10090 (Mus musculus)
Function annotation	BioLiP:3bd5A	BioLiP:3bd5B

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3bd5-a3-m1-cA_3bd5-a3-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3bd5-assembly3.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

2gki/3/2:A/2:B 2gki/3/1:A/1:B 2gki/4/3:A/4:B 2gki/3/1:A/2:B 2gki/3/2:A/1:B 2gki/4/1:A/2:B 2gki/4/1:A/4:B 2gki/4/3:A/2:B