3bde/2/1:B/3:B

Sequences
>3bde-a2-m1-cB (length=97) [Search sequence]
GIRHTVVFTLKHASHSLEEKRFLVDAKKILSAIRGVTHFEQLRQISPKIDYHFGFSEFAD
QAAYTRYNDHPDHVAFVRDRWVPEVEKFLEIDYVPLG
>3bde-a2-m3-cB (length=97) [Search sequence]
GIRHTVVFTLKHASHSLEEKRFLVDAKKILSAIRGVTHFEQLRQISPKIDYHFGFSEFAD
QAAYTRYNDHPDHVAFVRDRWVPEVEKFLEIDYVPLG
Structure information
PDB ID 3bde (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of a dabb family protein with a ferredoxin-like fold (mll5499) from mesorhizobium loti maff303099 at 1.79 A resolution
Assembly ID 2
Resolution 1.79Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 69
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 3
Chain ID B B
UniProt accession Q98BN1 Q98BN1
Species 266835 (Mesorhizobium japonicum MAFF 303099) 266835 (Mesorhizobium japonicum MAFF 303099)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3bde-a2-m1-cB_3bde-a2-m3-cB.pdb.gz
Full biological assembly
Download: 3bde-assembly2.cif.gz
Similar dimers

[Back to Home]