3bdu/1/1:A/1:E

Sequences
>3bdu-a1-m1-cA (length=51) [Search sequence]
SSNYVLHTNDGRTIVAEGKPKVDDETGISYTDAYGQQQQINRDNVKEAKGK
>3bdu-a1-m1-cE (length=51) [Search sequence]
SSNYVLHTNDGRTIVAEGKPKVDDETGISYTDAYGQQQQINRDNVKEAKGK
Structure information
PDB ID 3bdu (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of protein Q6D8G1 at the resolution 1.9 A. Northeast Structural Genomics Consortium target EwR22A.
Assembly ID 1
Resolution 1.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 30
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A E
UniProt accession Q6D8G1 Q6D8G1
Species 218491 (Pectobacterium atrosepticum SCRI1043) 218491 (Pectobacterium atrosepticum SCRI1043)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3bdu-a1-m1-cA_3bdu-a1-m1-cE.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3bdu-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3bdu/1/1:B/1:D 3bdu/1/1:B/1:G 3bdu/1/1:C/1:A 3bdu/1/1:C/1:G 3bdu/1/1:D/1:F 3bdu/1/1:F/1:E

[Back to Home]